Lineage for d1vf5e_ (1vf5 E:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1457443Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) (S)
  5. 1457444Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein)
  6. 1457445Protein PetL subunit of the cytochrome b6f complex [103438] (2 species)
  7. 1457448Species Mastigocladus laminosus [TaxId:83541] [103439] (6 PDB entries)
  8. 1457452Domain d1vf5e_: 1vf5 E: [100585]
    Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5s_, d1vf5t_, d1vf5u_
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1vf5e_

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus
PDB Compounds: (E:) protein pet l

SCOPe Domain Sequences for d1vf5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5e_ f.23.24.1 (E:) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
milgavfyivfialffgiavgiifaiksikli

SCOPe Domain Coordinates for d1vf5e_:

Click to download the PDB-style file with coordinates for d1vf5e_.
(The format of our PDB-style files is described here.)

Timeline for d1vf5e_: