SCOP 1.71: Domain d1vf5d2: 1vf5 D:12-45

Lineage for d1vf5d2 (1vf5 D:12-45)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103429] (1 PDB entry)

8. Domain d1vf5d2: 1vf5 D:12-45 [100584]
   Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_

Details for d1vf5d2

PDB Entry: 1vf5, 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

SCOP Domain Sequences for d1vf5d2:

Sequence; same for both SEQRES and ATOM records:

>d1vf5d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus}
dmgrrqfmnllafgtvtgvalgalyplvkyfipp

Timeline for d1vf5d2:

• d1vf5d2 first appeared in SCOP 1.67
  
• d1vf5d2 appears in SCOP 1.69
  
• d1vf5d2 appears in SCOP 1.73
  
• d1vf5d2 appears in the current release, SCOPe 2.08