![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (2 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins) |
![]() | Protein ISP subunit from the cytochrome b6f complex, soluble domain [101665] (2 species) |
![]() | Species Mastigocladus laminosus [TaxId:83541] [101666] (1 PDB entry) |
![]() | Domain d1vf5d1: 1vf5 D:46-179 [100583] Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_ |
PDB Entry: 1vf5 (more details), 3 Å
SCOP Domain Sequences for d1vf5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf5d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus} sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin avcthlgcvvpwnaaenkfkcpchgsqydetgrvirgpaplslalchatvqddnivltpw tetdfrtgekpwwv
Timeline for d1vf5d1: