Lineage for d1vf5c2 (1vf5 C:170-231)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471225Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 471273Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 471314Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)
  6. 471315Protein Cytochrome f, small domain [51257] (4 species)
  7. 471332Species Mastigocladus laminosus [TaxId:83541] [102005] (1 PDB entry)
  8. 471333Domain d1vf5c2: 1vf5 C:170-231 [100581]
    Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_

Details for d1vf5c2

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

SCOP Domain Sequences for d1vf5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5c2 b.84.2.2 (C:170-231) Cytochrome f, small domain {Mastigocladus laminosus}
nvftasatgtitkiakeedeygnvkyqvsiqtdsgktvvdtipagpelivsegqavkage
al

SCOP Domain Coordinates for d1vf5c2:

Click to download the PDB-style file with coordinates for d1vf5c2.
(The format of our PDB-style files is described here.)

Timeline for d1vf5c2: