Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species) |
Species Thermus thermophilus [TaxId:274] [103101] (1 PDB entry) |
Domain d1vc2a2: 1vc2 A:149-310 [100556] Other proteins in same PDB: d1vc2a1 complexed with nad |
PDB Entry: 1vc2 (more details), 2.6 Å
SCOPe Domain Sequences for d1vc2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vc2a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus thermophilus [TaxId: 274]} cttnslapvmkvlekafgvekalmttvhsytndqrlldlphkdlrraraaalniiptttg aakatalvlpslkgrfdgmalrvptptgsisditallkrevtaeevnaalkaaaegplkg ilaytedeivlrdivmdphssivdgkltkaignlvkvfawyd
Timeline for d1vc2a2: