SCOPe 2.06: Domain d1v9u.1: 1v9u 4:,2:

Lineage for d1v9u.1 (1v9u 4:,2:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Rhinovirus coat proteins [49670] (5 species)

7. Species Human rhinovirus A 2 (HRV-2) [TaxId:12130] [49674] (2 PDB entries)

8. Domain d1v9u.1: 1v9u 4:,2: [100550]
   Other proteins in same PDB: d1v9u5_
   complexed with ca, dao

Details for d1v9u.1

PDB Entry: 1v9u, 3.6 Å

PDB Description: Human Rhinovirus 2 bound to a fragment of its cellular receptor protein

PDB Compounds: (2:) coat protein vp2, (4:) coat protein vp4

SCOPe Domain Sequences for d1v9u.1:

Sequence, based on SEQRES records:

>g1v9u.1 b.121.4.1 (4:,2:) Rhinovirus coat proteins {Human rhinovirus A 2 (HRV-2) [TaxId: 12130]}
aqvsrqnvgthstqnsvsngsslnyfninyfkdaasngasklXriiqitrgdstitsqdv
anaivaygvwphylsskdasaidkpsqpdtssnrfytlrsvtwsssskgwwwklpdalkd
mgifgenmfyhylgrsgytihvqcnaskfhqgtlivalipehqiasalhgnvnvgynyth
pgetgrevkaetrlnpdlqpteeywlnfdgtllgnitifphqfinlrsnnsatiiapyvn
avpmdsmrshnnwslviipicpletssaintipitisispmcaefsgarakrq

Sequence, based on observed residues (ATOM records):

>g1v9u.1 b.121.4.1 (4:,2:) Rhinovirus coat proteins {Human rhinovirus A 2 (HRV-2) [TaxId: 12130]}
aqvsrqnyfninyfkdaasngasklXriiqitrgdstitsqdvanaivaygvwphylssk
dasaidkpsqpdtssnrfytlrsvtwsssskgwwwklpdalkdmgifgenmfyhylgrsg
ytihvqcnaskfhqgtlivalipehqiasalhgnvnvgynythpgetgrevkaetrlnpd
lqpteeywlnfdgtllgnitifphqfinlrsnnsatiiapyvnavpmdsmrshnnwslvi
ipicpletssaintipitisispmcaefsgarakrq

Timeline for d1v9u.1:

• d1v9u.1 first appeared in SCOP 1.67
  
• d1v9u.1 appears in SCOPe 2.05
  
• d1v9u.1 appears in SCOPe 2.07
  
• d1v9u.1 appears in the current release, SCOPe 2.08