Class a: All alpha proteins [46456] (284 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Thrombopoietin [101140] (1 species) long chain cytokine with a short-chain cytokine topology |
Species Human (Homo sapiens) [TaxId:9606] [101141] (2 PDB entries) |
Domain d1v7nz_: 1v7n Z: [100479] Other proteins in same PDB: d1v7nh1, d1v7nh2, d1v7ni1, d1v7ni2, d1v7nj1, d1v7nj2, d1v7nk1, d1v7nk2, d1v7nl1, d1v7nl2, d1v7nm1, d1v7nm2, d1v7nn1, d1v7nn2, d1v7no1, d1v7no2 |
PDB Entry: 1v7n (more details), 3.3 Å
SCOPe Domain Sequences for d1v7nz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v7nz_ a.26.1.2 (Z:) Thrombopoietin {Human (Homo sapiens) [TaxId: 9606]} lrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilgavt lllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrttahkdpnaif lsfqhllrgkvrflmlvg
Timeline for d1v7nz_: