Lineage for d1v7no2 (1v7n O:108-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656481Domain d1v7no2: 1v7n O:108-213 [100475]
    Other proteins in same PDB: d1v7nh1, d1v7nh2, d1v7ni1, d1v7ni2, d1v7nj1, d1v7nj2, d1v7nk1, d1v7nk2, d1v7nl1, d1v7nm1, d1v7nn1, d1v7no1, d1v7nv_, d1v7nx_, d1v7ny_, d1v7nz_
    part of anti-trombopoetin Fab tn1
    mutant

Details for d1v7no2

PDB Entry: 1v7n (more details), 3.3 Å

PDB Description: human thrombopoietin functional domain complexed to neutralizing antibody tn1 fab
PDB Compounds: (O:) Monoclonal TN1 Fab Light Chain

SCOP Domain Sequences for d1v7no2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7no2 b.1.1.2 (O:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1v7no2:

Click to download the PDB-style file with coordinates for d1v7no2.
(The format of our PDB-style files is described here.)

Timeline for d1v7no2: