SCOP 1.69: Domain d1v7nl1: 1v7n L:1-107

Lineage for d1v7nl1 (1v7n L:1-107)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (19 PDB entries)

8. Domain d1v7nl1: 1v7n L:1-107 [100468]
   Other proteins in same PDB: d1v7nh1, d1v7nh2, d1v7ni1, d1v7ni2, d1v7nj1, d1v7nj2, d1v7nk1, d1v7nk2, d1v7nl2, d1v7nm2, d1v7nn2, d1v7no2, d1v7nv_, d1v7nx_, d1v7ny_, d1v7nz_

Details for d1v7nl1

PDB Entry: 1v7n, 3.3 Å

PDB Description: human thrombopoietin functional domain complexed to neutralizing antibody tn1 fab

SCOP Domain Sequences for d1v7nl1:

Sequence; same for both SEQRES and ATOM records:

>d1v7nl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2}
qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikr

Timeline for d1v7nl1:

• d1v7nl1 first appeared in SCOP 1.67
  
• d1v7nl1 appears in SCOP 1.71
  
• d1v7nl1 appears in the current release, SCOPe 2.08