Lineage for d1v7mi2 (1v7m I:117-217)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655637Domain d1v7mi2: 1v7m I:117-217 [100453]
    Other proteins in same PDB: d1v7mh1, d1v7mi1, d1v7ml1, d1v7ml2, d1v7mm1, d1v7mm2, d1v7mv_, d1v7mx_
    part of anti-trombopoetin Fab tn1

Details for d1v7mi2

PDB Entry: 1v7m (more details), 2.51 Å

PDB Description: Human Thrombopoietin Functional Domain Complexed To Neutralizing Antibody TN1 Fab
PDB Compounds: (I:) Monoclonal TN1 Fab Heavy Chain

SCOP Domain Sequences for d1v7mi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7mi2 b.1.1.2 (I:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1v7mi2:

Click to download the PDB-style file with coordinates for d1v7mi2.
(The format of our PDB-style files is described here.)

Timeline for d1v7mi2: