Lineage for d1v7cc_ (1v7c C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907561Protein Threonine synthase [64172] (4 species)
  7. 2907578Species Thermus thermophilus [TaxId:274] [102667] (6 PDB entries)
  8. 2907587Domain d1v7cc_: 1v7c C: [100448]
    complexed with hey

Details for d1v7cc_

PDB Entry: 1v7c (more details), 2 Å

PDB Description: Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue
PDB Compounds: (C:) threonine synthase

SCOPe Domain Sequences for d1v7cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7cc_ c.79.1.1 (C:) Threonine synthase {Thermus thermophilus [TaxId: 274]}
mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll

SCOPe Domain Coordinates for d1v7cc_:

Click to download the PDB-style file with coordinates for d1v7cc_.
(The format of our PDB-style files is described here.)

Timeline for d1v7cc_: