SCOP 1.73: Domain d1v75b_: 1v75 B:

Lineage for d1v75b_ (1v75 B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (22 species)

7. Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100977] (2 PDB entries)

8. Domain d1v75b_: 1v75 B: [100445]
   Other proteins in same PDB: d1v75a_
   complexed with hem

Details for d1v75b_

PDB Entry: 1v75, 2.02 Å

PDB Description: crystal structure of hemoglobin d from the aldabra giant tortoise (geochelone gigantea) at 2.0 a resolution

PDB Compounds: (B:) Hemoglobin A and D beta chain

SCOP Domain Sequences for d1v75b_:

Sequence; same for both SEQRES and ATOM records:

>d1v75b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]}
hwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakvl
ahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpke
ftpasqaawtklvnavahalal

Timeline for d1v75b_:

• d1v75b_ first appeared in SCOP 1.67
  
• d1v75b_ appears in SCOP 1.71
  
• d1v75b_ appears in SCOP 1.75
  
• d1v75b_ appears in the current release, SCOPe 2.08