SCOP 1.75: Domain d1v55z_: 1v55 Z:

Lineage for d1v55z_ (1v55 Z:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family)

5. Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81428] (14 PDB entries)

8. Domain d1v55z_: 1v55 Z: [100376]
   Other proteins in same PDB: d1v55a_, d1v55b1, d1v55b2, d1v55c_, d1v55d_, d1v55e_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55n_, d1v55o1, d1v55o2, d1v55p_, d1v55q_, d1v55r_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v55z_

PDB Entry: 1v55, 1.9 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully reduced state

PDB Compounds: (Z:) Cytochrome c oxidase polypeptide VIII-heart

SCOP Domain Sequences for d1v55z_:

Sequence; same for both SEQRES and ATOM records:

>d1v55z_ f.23.7.1 (Z:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

Timeline for d1v55z_:

• d1v55z_ first appeared in SCOP 1.67
  
• d1v55z_ appears in SCOP 1.73
  
• d1v55z_ appears in SCOPe 2.01
  
• d1v55z_ appears in the current release, SCOPe 2.08