SCOP 1.67: Domain d1v55r_: 1v55 R:

Lineage for d1v55r_ (1v55 R:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family)

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)

6. Protein Cytochrome c oxidase subunit E [48481] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48482] (7 PDB entries)

8. Domain d1v55r_: 1v55 R: [100368]
   Other proteins in same PDB: d1v55a_, d1v55b1, d1v55b2, d1v55c_, d1v55d_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55n_, d1v55o1, d1v55o2, d1v55p_, d1v55q_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v55r_

PDB Entry: 1v55, 1.9 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully reduced state

SCOP Domain Sequences for d1v55r_:

Sequence; same for both SEQRES and ATOM records:

>d1v55r_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d1v55r_:

• d1v55r_ is new in SCOP 1.67
  
• d1v55r_ appears in SCOP 1.69
  
• d1v55r_ appears in the current release, SCOPe 2.08