| Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
| Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) ![]() |
| Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
| Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81444] (14 PDB entries) |
| Domain d1v55p_: 1v55 P: [100366] Other proteins in same PDB: d1v55a_, d1v55b1, d1v55b2, d1v55d_, d1v55e_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55n_, d1v55o1, d1v55o2, d1v55q_, d1v55r_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 1v55 (more details), 1.9 Å
SCOP Domain Sequences for d1v55p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v55p_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs
Timeline for d1v55p_:
View in 3DDomains from other chains: (mouse over for more information) d1v55a_, d1v55b1, d1v55b2, d1v55c_, d1v55d_, d1v55e_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55n_, d1v55o1, d1v55o2, d1v55q_, d1v55r_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_ |