Lineage for d1v55m_ (1v55 M:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620228Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 620337Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
  5. 620338Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (1 protein)
  6. 620339Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 620340Species Cow (Bos taurus) [TaxId:9913] [81428] (7 PDB entries)
  8. 620343Domain d1v55m_: 1v55 M: [100362]
    Other proteins in same PDB: d1v55a_, d1v55b1, d1v55b2, d1v55c_, d1v55d_, d1v55e_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55n_, d1v55o1, d1v55o2, d1v55p_, d1v55q_, d1v55r_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_

Details for d1v55m_

PDB Entry: 1v55 (more details), 1.9 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully reduced state
PDB Compounds: (M:)

SCOP Domain Sequences for d1v55m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v55m_ f.23.7.1 (M:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus)}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOP Domain Coordinates for d1v55m_:

Click to download the PDB-style file with coordinates for d1v55m_.
(The format of our PDB-style files is described here.)

Timeline for d1v55m_: