Lineage for d1v55b1 (1v55 B:91-227)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043698Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2043699Protein Cytochrome c oxidase [49544] (4 species)
  7. 2043700Species Cow (Bos taurus) [TaxId:9913] [49545] (35 PDB entries)
  8. 2043713Domain d1v55b1: 1v55 B:91-227 [100350]
    Other proteins in same PDB: d1v55a_, d1v55b2, d1v55c_, d1v55d_, d1v55e_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55n_, d1v55o2, d1v55p_, d1v55q_, d1v55r_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v55b1

PDB Entry: 1v55 (more details), 1.9 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully reduced state
PDB Compounds: (B:) cytochrome c oxidase polypeptide II

SCOPe Domain Sequences for d1v55b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v55b1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d1v55b1:

Click to download the PDB-style file with coordinates for d1v55b1.
(The format of our PDB-style files is described here.)

Timeline for d1v55b1: