Lineage for d1v54r_ (1v54 R:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 543192Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 543193Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 543194Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 543195Species Cow (Bos taurus) [TaxId:9913] [48482] (7 PDB entries)
  8. 543197Domain d1v54r_: 1v54 R: [100340]
    Other proteins in same PDB: d1v54a_, d1v54b1, d1v54b2, d1v54c_, d1v54d_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o1, d1v54o2, d1v54p_, d1v54q_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v54r_

PDB Entry: 1v54 (more details), 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1v54r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v54r_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d1v54r_:

Click to download the PDB-style file with coordinates for d1v54r_.
(The format of our PDB-style files is described here.)

Timeline for d1v54r_: