SCOP 1.67: Domain d1v54p_: 1v54 P:

Lineage for d1v54p_ (1v54 P:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family)

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (7 PDB entries)

8. Domain d1v54p_: 1v54 P: [100338]
   Other proteins in same PDB: d1v54a_, d1v54b1, d1v54b2, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o1, d1v54o2, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v54p_

PDB Entry: 1v54, 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1v54p_:

Sequence; same for both SEQRES and ATOM records:

>d1v54p_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus)}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d1v54p_:

• d1v54p_ is new in SCOP 1.67
  
• d1v54p_ appears in SCOP 1.69
  
• d1v54p_ appears in the current release, SCOPe 2.08