| Class b: All beta proteins [48724] (178 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
| Protein Cytochrome c oxidase [49544] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [49545] (45 PDB entries) |
| Domain d1v54o1: 1v54 O:91-227 [100336] Other proteins in same PDB: d1v54a_, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o2, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 1v54 (more details), 1.8 Å
SCOPe Domain Sequences for d1v54o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v54o1 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml
Timeline for d1v54o1:
View in 3DDomains from other chains: (mouse over for more information) d1v54a_, d1v54b1, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_ |