SCOPe 2.06: Domain d1v54o1: 1v54 O:91-227

Lineage for d1v54o1 (1v54 O:91-227)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49545] (35 PDB entries)

8. Domain d1v54o1: 1v54 O:91-227 [100336]
   Other proteins in same PDB: d1v54a_, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o2, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v54o1

PDB Entry: 1v54, 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (O:) cytochrome c oxidase polypeptide II

SCOPe Domain Sequences for d1v54o1:

Sequence; same for both SEQRES and ATOM records:

>d1v54o1 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

Timeline for d1v54o1:

• d1v54o1 first appeared in SCOP 1.67
  
• d1v54o1 appears in SCOPe 2.05
  
• d1v54o1 appears in SCOPe 2.07
  
• d1v54o1 appears in the current release, SCOPe 2.08