Lineage for d1v54h_ (1v54 H:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539008Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 539009Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 539010Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 539011Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 539012Species Cow (Bos taurus) [TaxId:9913] [47697] (7 PDB entries)
  8. 539013Domain d1v54h_: 1v54 H: [100329]
    Other proteins in same PDB: d1v54a_, d1v54b1, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o1, d1v54o2, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_

Details for d1v54h_

PDB Entry: 1v54 (more details), 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1v54h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v54h_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d1v54h_:

Click to download the PDB-style file with coordinates for d1v54h_.
(The format of our PDB-style files is described here.)

Timeline for d1v54h_: