SCOPe 2.07: Domain d1v54g_: 1v54 G:

Lineage for d1v54g_ (1v54 G:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)
   automatically mapped to Pfam PF02046

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (51 PDB entries)

8. Domain d1v54g_: 1v54 G: [100328]
   Other proteins in same PDB: d1v54a_, d1v54b1, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o1, d1v54o2, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v54g_

PDB Entry: 1v54, 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (G:) Cytochrome c oxidase polypeptide VIa-heart

SCOPe Domain Sequences for d1v54g_:

Sequence; same for both SEQRES and ATOM records:

>d1v54g_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d1v54g_:

• d1v54g_ first appeared in SCOP 1.67
  
• d1v54g_ appears in SCOPe 2.06
  
• d1v54g_ appears in the current release, SCOPe 2.08