Lineage for d1v54g_ (1v54 G:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238023Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
  5. 1238024Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 1238025Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 1238026Species Cow (Bos taurus) [TaxId:9913] [81408] (23 PDB entries)
  8. 1238031Domain d1v54g_: 1v54 G: [100328]
    Other proteins in same PDB: d1v54a_, d1v54b1, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o1, d1v54o2, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v54g_

PDB Entry: 1v54 (more details), 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (G:) Cytochrome c oxidase polypeptide VIa-heart

SCOPe Domain Sequences for d1v54g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v54g_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d1v54g_:

Click to download the PDB-style file with coordinates for d1v54g_.
(The format of our PDB-style files is described here.)

Timeline for d1v54g_: