Lineage for d1v54b1 (1v54 B:91-227)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369112Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 369113Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 369398Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 369399Protein Cytochrome c oxidase [49544] (4 species)
  7. 369400Species Cow (Bos taurus) [TaxId:9913] [49545] (7 PDB entries)
  8. 369401Domain d1v54b1: 1v54 B:91-227 [100322]
    Other proteins in same PDB: d1v54a_, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o2, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_

Details for d1v54b1

PDB Entry: 1v54 (more details), 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1v54b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v54b1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus)}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOP Domain Coordinates for d1v54b1:

Click to download the PDB-style file with coordinates for d1v54b1.
(The format of our PDB-style files is described here.)

Timeline for d1v54b1: