Lineage for d1v4sa2 (1v4s A:219-461)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586265Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families) (S)
    duplication contains two domains of this fold
  5. 586454Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 586455Protein Glucokinase [102479] (1 species)
    Hexokinase D
  7. 586456Species Human (Homo sapiens) [TaxId:9606] [102480] (2 PDB entries)
  8. 586458Domain d1v4sa2: 1v4s A:219-461 [100310]
    complexed with agc, mrk, na

Details for d1v4sa2

PDB Entry: 1v4s (more details), 2.3 Å

PDB Description: crystal structure of human glucokinase

SCOP Domain Sequences for d1v4sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4sa2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens)}
qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd
essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv
esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs
edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack
kac

SCOP Domain Coordinates for d1v4sa2:

Click to download the PDB-style file with coordinates for d1v4sa2.
(The format of our PDB-style files is described here.)

Timeline for d1v4sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v4sa1