| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.3: Hexokinase [53083] (3 proteins) |
| Protein Glucokinase [102479] (1 species) Hexokinase D |
| Species Human (Homo sapiens) [TaxId:9606] [102480] (2 PDB entries) |
| Domain d1v4sa1: 1v4s A:14-218 [100309] |
PDB Entry: 1v4s (more details), 2.3 Å
SCOP Domain Sequences for d1v4sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v4sa1 c.55.1.3 (A:14-218) Glucokinase {Human (Homo sapiens)}
tlveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgd
flsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdf
ldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrg
dfemdvvamvndtvatmiscyyedh
Timeline for d1v4sa1: