Class b: All beta proteins [48724] (180 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (15 families) |
Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein) contains extra structures; some similarity to the PK beta-barrel domain automatically mapped to Pfam PF14306 |
Protein ATP sulfurylase N-terminal domain [63802] (5 species) |
Species Thermus thermophilus [TaxId:274] [102027] (1 PDB entry) |
Domain d1v47b1: 1v47 B:4-135 [100294] Other proteins in same PDB: d1v47a2, d1v47b2 complexed with adx, cl, na, zn |
PDB Entry: 1v47 (more details), 2.49 Å
SCOPe Domain Sequences for d1v47b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v47b1 b.122.1.3 (B:4-135) ATP sulfurylase N-terminal domain {Thermus thermophilus [TaxId: 274]} tlpaleigederldlenlatgaffpvkgfmtreealsvahemrlptgevwtipillqfre kprvgpgntvallhggervallhvaeayeldlealaravfgtdsethpgvarlygkgpya lagrvevlkprp
Timeline for d1v47b1: