SCOPe 2.08: Domain d1v47b1: 1v47 B:4-135

Lineage for d1v47b1 (1v47 B:4-135)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
   contains extra structures; some similarity to the PK beta-barrel domain
   automatically mapped to Pfam PF14306

6. Protein ATP sulfurylase N-terminal domain [63802] (5 species)

7. Species Thermus thermophilus [TaxId:274] [102027] (1 PDB entry)

8. Domain d1v47b1: 1v47 B:4-135 [100294]
   Other proteins in same PDB: d1v47a2, d1v47b2
   complexed with adx, cl, na, zn

Details for d1v47b1

PDB Entry: 1v47, 2.49 Å

PDB Description: Crystal structure of ATP sulfurylase from Thermus thermophillus HB8 in complex with APS

PDB Compounds: (B:) ATP sulfurylase

SCOPe Domain Sequences for d1v47b1:

Sequence; same for both SEQRES and ATOM records:

>d1v47b1 b.122.1.3 (B:4-135) ATP sulfurylase N-terminal domain {Thermus thermophilus [TaxId: 274]}
tlpaleigederldlenlatgaffpvkgfmtreealsvahemrlptgevwtipillqfre
kprvgpgntvallhggervallhvaeayeldlealaravfgtdsethpgvarlygkgpya
lagrvevlkprp

Timeline for d1v47b1:

• d1v47b1 first appeared in SCOP 1.67
  
• d1v47b1 appears in SCOPe 2.07