Lineage for d1v47a2 (1v47 A:136-349)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392101Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 392102Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 392372Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)
  6. 392373Protein ATP sulfurylase central domain [63980] (4 species)
  7. 392396Species Thermus thermophilus [TaxId:274] [102262] (1 PDB entry)
    lacks the C-terminal domain
  8. 392397Domain d1v47a2: 1v47 A:136-349 [100293]
    Other proteins in same PDB: d1v47a1, d1v47b1

Details for d1v47a2

PDB Entry: 1v47 (more details), 2.49 Å

PDB Description: Crystal structure of ATP sulfurylase from Thermus thermophillus HB8 in complex with APS

SCOP Domain Sequences for d1v47a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v47a2 c.26.1.5 (A:136-349) ATP sulfurylase central domain {Thermus thermophilus}
rtplektpeevraffrqrgwrkvvafqtrnaphraheylirlgleladgvlvhpilgakk
pddfpteviveayqalirdflpqervaffglatpmryagpkeavfhalvrknfgathflv
grdhagvgdfydpyaahrifdrlpplgieivkvgavfhcplcggiasertcpeghrekrt
aismtkvrallregkappselvrpellpilrrgv

SCOP Domain Coordinates for d1v47a2:

Click to download the PDB-style file with coordinates for d1v47a2.
(The format of our PDB-style files is described here.)

Timeline for d1v47a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v47a1