Lineage for d1v2ya_ (1v2y A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 407835Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 407836Family d.15.1.1: Ubiquitin-related [54237] (14 proteins)
  6. 407926Protein Ubiquitin-like protein 3300001g02rik [102784] (1 species)
  7. 407927Species Mouse (Mus musculus) [TaxId:10090] [102785] (1 PDB entry)
  8. 407928Domain d1v2ya_: 1v2y A: [100275]
    structural genomics

Details for d1v2ya_

PDB Entry: 1v2y (more details)

PDB Description: solution structure of mouse hypothetical gene (riken cdna 3300001g02) product homologous to ubiquitin fold

SCOP Domain Sequences for d1v2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus)}
gssgssgmtvrvckmdgevmpvvvvqnatvldlkkaiqryvqlkqereggvqhiswsyvw
rtyhltsagekltedrkklrdygirnrdevsfikklgqksgpssg

SCOP Domain Coordinates for d1v2ya_:

Click to download the PDB-style file with coordinates for d1v2ya_.
(The format of our PDB-style files is described here.)

Timeline for d1v2ya_: