SCOP 1.73: Domain d1v0ba_: 1v0b A:

Lineage for d1v0ba_ (1v0b A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species (Plasmodium falciparum) [TaxId:5833] [103289] (4 PDB entries)
   CDK2 homologue Pfpk5

8. Domain d1v0ba_: 1v0b A: [100241]

Details for d1v0ba_

PDB Entry: 1v0b, 2.2 Å

PDB Description: crystal structure of the t198a mutant of pfpk5

PDB Compounds: (A:) cell division control protein 2 homolog

SCOP Domain Sequences for d1v0ba_:

Sequence; same for both SEQRES and ATOM records:

>d1v0ba_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]}
mekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhs
nivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrr
vlhrdlkpqnllinregelkiadfglarafgipvrkythevvtlwyrapdvlmgskkyst
tidiwsvgcifaemvngaplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftv
yeplpwesflkgldesgidllskmlkldpnqritakqalehayfken

Timeline for d1v0ba_:

• d1v0ba_ first appeared in SCOP 1.67
  
• d1v0ba_ appears in SCOP 1.71
  
• d1v0ba_ appears in SCOP 1.75
  
• d1v0ba_ appears in the current release, SCOPe 2.08