SCOPe 2.01: Domain d1uzxa_: 1uzx A:

Lineage for d1uzxa_ (1uzx A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.2: UEV domain [75383] (3 proteins)

6. Protein Vacuolar protein sorting-associated [102843] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102844] (1 PDB entry)

8. Domain d1uzxa_: 1uzx A: [100238]
   Other proteins in same PDB: d1uzxb_
   complexed with mes, so4

Details for d1uzxa_

PDB Entry: 1uzx, 1.85 Å

PDB Description: a complex of the vps23 uev with ubiquitin

PDB Compounds: (A:) vacuolar protein sorting-associated protein vps23

SCOPe Domain Sequences for d1uzxa_:

Sequence, based on SEQRES records:

>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgtpqlllsiyg
tistgedgssphsipvimwvpsmypvkppfisinlenfdmntissslpiqeyidsngwia
lpilhcwdpaamnlimvvqelmsllheppqdq

Sequence, based on observed residues (ATOM records):

>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgtpqlllsiyg
tistgsipvimwvpsmypvkppfisinlenfdmntlpiqeyidsngwialpilhcwdpaa
mnlimvvqelmsllheppqdq

Timeline for d1uzxa_:

• d1uzxa_ first appeared in SCOP 1.67
  
• d1uzxa_ appears in SCOP 1.75
  
• d1uzxa_ appears in SCOPe 2.02
  
• d1uzxa_ appears in the current release, SCOPe 2.08