Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (4 families) |
Family d.20.1.2: UEV domain [75383] (2 proteins) |
Protein Vacuolar protein sorting-associated [102843] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102844] (1 PDB entry) |
Domain d1uzxa_: 1uzx A: [100238] Other proteins in same PDB: d1uzxb_ complexed with mes, mso, so4 |
PDB Entry: 1uzx (more details), 1.85 Å
SCOP Domain Sequences for d1uzxa_:
Sequence, based on SEQRES records: (download)
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} svpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgtpqlllsiyg tistgedgssphsipvimwvpsmypvkppfisinlenfdmntissslpiqeyidsngwia lpilhcwdpaamnlimvvqelmsllheppqdq
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} svpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgtpqlllsiyg tistgsipvimwvpsmypvkppfisinlenfdmntlpiqeyidsngwialpilhcwdpaa mnlimvvqelmsllheppqdq
Timeline for d1uzxa_: