Lineage for d1uzqa2 (1uzq A:1605-1647)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062283Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1062284Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1062484Protein Fibrillin-1 [57227] (1 species)
    duplication: contains 47 EFG-like domains
  7. 1062485Species Human (Homo sapiens) [TaxId:9606] [57228] (7 PDB entries)
  8. 1062497Domain d1uzqa2: 1uzq A:1605-1647 [100236]
    Other proteins in same PDB: d1uzqa3
    CBEGF22 and CBEGF23

Details for d1uzqa2

PDB Entry: 1uzq (more details), 2.4 Å

PDB Description: integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, apo form cbegf23 domain only.
PDB Compounds: (A:) fibrillin-1

SCOPe Domain Sequences for d1uzqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzqa2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}
edidecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd

SCOPe Domain Coordinates for d1uzqa2:

Click to download the PDB-style file with coordinates for d1uzqa2.
(The format of our PDB-style files is described here.)

Timeline for d1uzqa2: