Lineage for d1uzpa2 (1uzp A:1605-1647)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636224Protein Fibrillin-1 [57227] (1 species)
    duplication: contains 47 EFG-like domains
  7. 2636225Species Human (Homo sapiens) [TaxId:9606] [57228] (7 PDB entries)
  8. 2636229Domain d1uzpa2: 1uzp A:1605-1647 [100233]
    Other proteins in same PDB: d1uzpa3
    CBEGF22 and CBEGF23
    complexed with sm

Details for d1uzpa2

PDB Entry: 1uzp (more details), 1.78 Å

PDB Description: integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, sm bound form cbegf23 domain only.
PDB Compounds: (A:) fibrillin-1

SCOPe Domain Sequences for d1uzpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzpa2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}
edidecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd

SCOPe Domain Coordinates for d1uzpa2:

Click to download the PDB-style file with coordinates for d1uzpa2.
(The format of our PDB-style files is described here.)

Timeline for d1uzpa2: