Class g: Small proteins [56992] (79 folds) |
Fold g.23: TB module/8-cys domain [57580] (1 superfamily) disulfide-rich; alpha+beta |
Superfamily g.23.1: TB module/8-cys domain [57581] (1 family) |
Family g.23.1.1: TB module/8-cys domain [57582] (2 proteins) transforming growth factor beta binding protein-like domain |
Protein Fibrillin [57583] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57584] (4 PDB entries) |
Domain d1uzjc3: 1uzj C:3529-3604 [100231] Other proteins in same PDB: d1uzja1, d1uzja2, d1uzjb1, d1uzjb2, d1uzjc1, d1uzjc2 TB4 complexed with ca |
PDB Entry: 1uzj (more details), 2.25 Å
SCOP Domain Sequences for d1uzjc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzjc3 g.23.1.1 (C:3529-3604) Fibrillin {Human (Homo sapiens)} trsgncyldirprgdngdtacsneigvgvskascccslgkawgtpcemcpavntseykil cpggegfrpnpitvil
Timeline for d1uzjc3: