Lineage for d1uzjc2 (1uzj C:3605-3647)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747896Protein Fibrillin-1 [57227] (1 species)
    duplication: contains 47 EFG-like domains
  7. 747897Species Human (Homo sapiens) [TaxId:9606] [57228] (7 PDB entries)
  8. 747907Domain d1uzjc2: 1uzj C:3605-3647 [100230]
    Other proteins in same PDB: d1uzja3, d1uzjb3, d1uzjc3
    CBEGF22 and CBEGF23
    complexed with ca

Details for d1uzjc2

PDB Entry: 1uzj (more details), 2.25 Å

PDB Description: integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, holo form.
PDB Compounds: (C:) fibrillin-1

SCOP Domain Sequences for d1uzjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzjc2 g.3.11.1 (C:3605-3647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}
edidecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd

SCOP Domain Coordinates for d1uzjc2:

Click to download the PDB-style file with coordinates for d1uzjc2.
(The format of our PDB-style files is described here.)

Timeline for d1uzjc2: