Lineage for d1uwhb_ (1uwh B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1671973Protein B-Raf kinase [103290] (1 species)
    OPK group; RAF subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases
  7. 1671974Species Human (Homo sapiens) [TaxId:9606] [103291] (2 PDB entries)
  8. 1671976Domain d1uwhb_: 1uwh B: [100124]
    complexed with bax, cl

Details for d1uwhb_

PDB Entry: 1uwh (more details), 2.95 Å

PDB Description: the complex of wild type b-raf and bay439006.
PDB Compounds: (B:) B-Raf proto-oncogene serine/threonine-protein kinase

SCOPe Domain Sequences for d1uwhb_:

Sequence, based on SEQRES records: (download)

>d1uwhb_ d.144.1.7 (B:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm
qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
amkrlmaeclkkkrderplfpqilasiellarslpk

Sequence, based on observed residues (ATOM records): (download)

>d1uwhb_ d.144.1.7 (B:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglatvlsgsilwmapevirmqdknpysfqsdv
yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
krderplfpqilasiellarslpk

SCOPe Domain Coordinates for d1uwhb_:

Click to download the PDB-style file with coordinates for d1uwhb_.
(The format of our PDB-style files is described here.)

Timeline for d1uwhb_: