SCOP 1.73: Domain d1uwgl1: 1uwg L:1-107

Lineage for d1uwgl1 (1uwg L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1uwgl1: 1uwg L:1-107 [100117]
   Other proteins in same PDB: d1uwgh1, d1uwgh2, d1uwgl2, d1uwgx2, d1uwgy1, d1uwgy2

Details for d1uwgl1

PDB Entry: 1uwg, 2.79 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9

PDB Compounds: (L:) antibody 14d9

SCOP Domain Sequences for d1uwgl1:

Sequence; same for both SEQRES and ATOM records:

>d1uwgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
elvmtqspkfmstsvgdrvsvtckasqnvgthvawyqqkpgqspktliysasyrysgvpd
rftgsgsgtdftltirdvqsedaaeyfcqqynlfpvtfgggtkleik

Timeline for d1uwgl1:

• d1uwgl1 first appeared in SCOP 1.67
  
• d1uwgl1 appears in SCOP 1.71
  
• d1uwgl1 appears in SCOP 1.75
  
• d1uwgl1 appears in the current release, SCOPe 2.08