Lineage for d1uwey1 (1uwe Y:4-113)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1103919Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (152 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1104068Domain d1uwey1: 1uwe Y:4-113 [100113]
    Other proteins in same PDB: d1uweh2, d1uwel1, d1uwel2, d1uweu1, d1uweu2, d1uwev2, d1uwex1, d1uwex2, d1uwey2
    part of catalytic Fab 14d9

Details for d1uwey1

PDB Entry: 1uwe (more details), 2.67 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9
PDB Compounds: (Y:) antibody 14d9

SCOPe Domain Sequences for d1uwey1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwey1 b.1.1.1 (Y:4-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
llaqsgpelvkpgasvkiscaasaysitdftiywvkqshgdslewiggidphngggaynq
kfrvkatltvdtssstayihlnsltsedsavyycaifygnffdywgqgttvtvss

SCOPe Domain Coordinates for d1uwey1:

Click to download the PDB-style file with coordinates for d1uwey1.
(The format of our PDB-style files is described here.)

Timeline for d1uwey1: