Lineage for d1uvya_ (1uvy A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253687Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 1253688Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 1253691Species Ciliate (Paramecium caudatum) [TaxId:5885] [46461] (2 PDB entries)
  8. 1253693Domain d1uvya_: 1uvy A: [100068]
    complexed with hem, xe

Details for d1uvya_

PDB Entry: 1uvy (more details), 2.4 Å

PDB Description: heme-ligand tunneling in group i truncated hemoglobins
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1uvya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvya_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]}
slfeqlggqaavqavtaqfyaniqadatvatffngidmpnqtnktaaflcaalggpnawt
grnlkevhanmgvsnaqfttvighlrsaltgagvaaalveqtvavaetvrgdvvtv

SCOPe Domain Coordinates for d1uvya_:

Click to download the PDB-style file with coordinates for d1uvya_.
(The format of our PDB-style files is described here.)

Timeline for d1uvya_: