Lineage for d1uvqb2 (1uvq B:3-94)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545431Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2545437Species Human (Homo sapiens), HLA-DQ6 [TaxId:9606] [102836] (1 PDB entry)
  8. 2545438Domain d1uvqb2: 1uvq B:3-94 [100065]
    Other proteins in same PDB: d1uvqa1, d1uvqa2, d1uvqb1
    complexed with a hypocretin peptide
    complexed with acy, gly, nag, zn

Details for d1uvqb2

PDB Entry: 1uvq (more details), 1.8 Å

PDB Description: crystal structure of hla-dq0602 in complex with a hypocretin peptide
PDB Compounds: (B:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1uvqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvqb2 d.19.1.1 (B:3-94) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DQ6 [TaxId: 9606]}
spedfvfqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtpqgrpdaeywn
sqkevlegtraeldtvcrhnyevafrgilqrr

SCOPe Domain Coordinates for d1uvqb2:

Click to download the PDB-style file with coordinates for d1uvqb2.
(The format of our PDB-style files is described here.)

Timeline for d1uvqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uvqb1