SCOP 1.67: Domain d1uvqa2: 1uvq A:2-84

Lineage for d1uvqa2 (1uvq A:2-84)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DQ6 [TaxId:9606] [102834] (1 PDB entry)

8. Domain d1uvqa2: 1uvq A:2-84 [100063]
   Other proteins in same PDB: d1uvqa1, d1uvqb1, d1uvqb2
   complexed with a hypocretin peptide
   complexed with acy, bma, fuc, gly, nag, zn

Details for d1uvqa2

PDB Entry: 1uvq, 1.8 Å

PDB Description: crystal structure of hla-dq0602 in complex with a hypocretin peptide

SCOP Domain Sequences for d1uvqa2:

Sequence; same for both SEQRES and ATOM records:

>d1uvqa2 d.19.1.1 (A:2-84) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DQ6}
divadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqg
alrnmavakhnlnimikrynsta

Timeline for d1uvqa2:

• d1uvqa2 is new in SCOP 1.67
  
• d1uvqa2 appears in SCOP 1.69
  
• d1uvqa2 appears in the current release, SCOPe 2.08