SCOPe 2.01: Domain d1uuzb_: 1uuz B:

Lineage for d1uuzb_ (1uuz B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
   alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet

4. Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family)

5. Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein)

6. Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
   formerly hypothetical protein YkfE

7. Species Pseudomonas aeruginosa [TaxId:287] [89876] (1 PDB entry)

8. Domain d1uuzb_: 1uuz B: [100025]
   Other proteins in same PDB: d1uuzc_, d1uuzd_
   complexed with lysozyme

Details for d1uuzb_

PDB Entry: 1uuz, 1.8 Å

PDB Description: ivy:a new family of protein

PDB Compounds: (B:) inhibitor of vertebrate lysozyme

SCOPe Domain Sequences for d1uuzb_:

Sequence; same for both SEQRES and ATOM records:

>d1uuzb_ d.233.1.1 (B:) Inhibitor of vertebrate lysozyme, Ivy {Pseudomonas aeruginosa [TaxId: 287]}
eqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansckp
hdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmkq
lesdpnwkl

Timeline for d1uuzb_:

• d1uuzb_ first appeared in SCOP 1.67
  
• d1uuzb_ appears in SCOP 1.75
  
• d1uuzb_ appears in SCOPe 2.02
  
• d1uuzb_ appears in the current release, SCOPe 2.08, called d1uuzb1