Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily) alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet |
Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) |
Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein) |
Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species) formerly hypothetical protein YkfE |
Species Pseudomonas aeruginosa [TaxId:287] [89876] (1 PDB entry) |
Domain d1uuzb_: 1uuz B: [100025] Other proteins in same PDB: d1uuzc_, d1uuzd_ complexed with lysozyme |
PDB Entry: 1uuz (more details), 1.8 Å
SCOP Domain Sequences for d1uuzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uuzb_ d.233.1.1 (B:) Inhibitor of vertebrate lysozyme, Ivy {Pseudomonas aeruginosa} eqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansckp hdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmkq lesdpnwkl
Timeline for d1uuzb_: