Lineage for d1uusa3 (1uus A:577-707)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415905Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 415906Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 415907Family d.93.1.1: SH2 domain [55551] (28 proteins)
  6. 416117Protein STAT homologue [103137] (1 species)
  7. 416118Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [103138] (2 PDB entries)
  8. 416120Domain d1uusa3: 1uus A:577-707 [100021]
    Other proteins in same PDB: d1uusa1, d1uusa2

Details for d1uusa3

PDB Entry: 1uus (more details), 2.8 Å

PDB Description: structure of an activated dictyostelium stat in its dna-unbound form

SCOP Domain Sequences for d1uusa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uusa3 d.93.1.1 (A:577-707) STAT homologue {Slime mold (Dictyostelium discoideum)}
rhistlwqegiiygymgrqevndalqnqdpgtfiirfsernpgqfgiayigvemparikh
ylvqpndtaaakktfpdflsehsqfvnllqwtkdtngaprflklhkdtalgsfapkrtap
vpvggyeplns

SCOP Domain Coordinates for d1uusa3:

Click to download the PDB-style file with coordinates for d1uusa3.
(The format of our PDB-style files is described here.)

Timeline for d1uusa3: