Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (28 proteins) |
Protein STAT homologue [103137] (1 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [103138] (2 PDB entries) |
Domain d1uusa3: 1uus A:577-707 [100021] Other proteins in same PDB: d1uusa1, d1uusa2 |
PDB Entry: 1uus (more details), 2.8 Å
SCOP Domain Sequences for d1uusa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uusa3 d.93.1.1 (A:577-707) STAT homologue {Slime mold (Dictyostelium discoideum)} rhistlwqegiiygymgrqevndalqnqdpgtfiirfsernpgqfgiayigvemparikh ylvqpndtaaakktfpdflsehsqfvnllqwtkdtngaprflklhkdtalgsfapkrtap vpvggyeplns
Timeline for d1uusa3: