Class b: All beta proteins [48724] (141 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (6 families) |
Family b.2.5.5: STAT DNA-binding domain [81317] (3 proteins) |
Protein STAT homologue [101554] (1 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101555] (2 PDB entries) |
Domain d1uusa2: 1uus A:360-576 [100020] Other proteins in same PDB: d1uusa1, d1uusa3 |
PDB Entry: 1uus (more details), 2.8 Å
SCOP Domain Sequences for d1uusa2:
Sequence, based on SEQRES records: (download)
>d1uusa2 b.2.5.5 (A:360-576) STAT homologue {Slime mold (Dictyostelium discoideum)} pnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshptnknn pttplemdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesdasnpf vvitnecqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrplssyd lkyiqthffgnrsiihqqdfdkfwvwfgksmqtlryq
>d1uusa2 b.2.5.5 (A:360-576) STAT homologue {Slime mold (Dictyostelium discoideum)} pnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshpnpttp lemdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesdasnpfvvit necqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrplssydlkyi qthffgnrsiihqqdfdkfwvwfgksmqtlryq
Timeline for d1uusa2: