Lineage for d1uusa1 (1uus A:239-359)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356427Fold a.47: STAT-like [47654] (2 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 356428Superfamily a.47.1: STAT [47655] (1 family) (S)
  5. 356429Family a.47.1.1: STAT [47656] (3 proteins)
  6. 356430Protein STAT homologue coiled coil domain [101220] (1 species)
  7. 356431Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101221] (2 PDB entries)
  8. 356433Domain d1uusa1: 1uus A:239-359 [100019]
    Other proteins in same PDB: d1uusa2, d1uusa3
    three-helical fragment

Details for d1uusa1

PDB Entry: 1uus (more details), 2.8 Å

PDB Description: structure of an activated dictyostelium stat in its dna-unbound form

SCOP Domain Sequences for d1uusa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uusa1 a.47.1.1 (A:239-359) STAT homologue coiled coil domain {Slime mold (Dictyostelium discoideum)}
pnlsspqpildtiykllseqeqtlvqmiheqslllnrlpptldenslaplkslsqkqitl
sgqmntemsaldatkkgmileptdlaklfalkqdlqiqfkqlsllhneiqsilnpqhsap
k

SCOP Domain Coordinates for d1uusa1:

Click to download the PDB-style file with coordinates for d1uusa1.
(The format of our PDB-style files is described here.)

Timeline for d1uusa1: