Lineage for d1uura1 (1uur A:242-359)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356427Fold a.47: STAT-like [47654] (2 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 356428Superfamily a.47.1: STAT [47655] (1 family) (S)
  5. 356429Family a.47.1.1: STAT [47656] (3 proteins)
  6. 356430Protein STAT homologue coiled coil domain [101220] (1 species)
  7. 356431Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101221] (2 PDB entries)
  8. 356432Domain d1uura1: 1uur A:242-359 [100016]
    Other proteins in same PDB: d1uura2, d1uura3
    three-helical fragment

Details for d1uura1

PDB Entry: 1uur (more details), 2.7 Å

PDB Description: structure of an activated dictyostelium stat in its dna-unbound form

SCOP Domain Sequences for d1uura1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uura1 a.47.1.1 (A:242-359) STAT homologue coiled coil domain {Slime mold (Dictyostelium discoideum)}
sspqpildtiykllseqeqtlvqmiheqslllnrlpptldenslaplkslsqkqitlsgq
mntemsaldatkkgmileptdlaklfalkqdlqiqfkqlsllhneiqsilnpqhsapk

SCOP Domain Coordinates for d1uura1:

Click to download the PDB-style file with coordinates for d1uura1.
(The format of our PDB-style files is described here.)

Timeline for d1uura1: