Lineage for d1uufa1 (1uuf A:3-144,A:313-349)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461906Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 461907Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 461986Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (13 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 462206Protein Hypothetical protein YahK [101708] (1 species)
  7. 462207Species Escherichia coli [TaxId:562] [101709] (1 PDB entry)
  8. 462208Domain d1uufa1: 1uuf A:3-144,A:313-349 [100006]
    Other proteins in same PDB: d1uufa2

Details for d1uufa1

PDB Entry: 1uuf (more details), 1.76 Å

PDB Description: crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk

SCOP Domain Sequences for d1uufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli}
ikavgaysakqplepmditrrepgpndvkieiaycgvchsdlhqvrsewagtvypcvpgh
eivgrvvavgdqvekyapgdlvgvgcivdsckhceecedglenycdhmtgtynsptpdep
ghtlggysqqivvheryvlrirXvadiemiradqineayermlrgdvkyrfvidnrtltd

SCOP Domain Coordinates for d1uufa1:

Click to download the PDB-style file with coordinates for d1uufa1.
(The format of our PDB-style files is described here.)

Timeline for d1uufa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uufa2